CN EN

AI prediction and development platform

Sequence analysis

EVQLVESGGGLVQPGGSLRLSCAASGFNIKDT

YIHWVRQAPGKGLEWVARIYPTNGYTRYADS

VKGRFTISADTSKNTAYLQMNSLRAEDTAVYYC

SRWGGDGFYAMDYWGQGTLVTVSS

Sequence analysis
  • The variable region of heavy and light chain (VH/VL) isprone to change
  • Deamidation sites (NG, NS, QG)
  • Isomerization sites (DG, DS)
  • Cleavage sites (DP, TS)
  • Amino acids containing benzene ring in the VH/VL
  • WYF clusters in the CDR region
  • Tryptophan in heavy chain CDR3
  • Variable region and isoelectric point of intact protein
  • CDR length
  • Extra N-glycosylation sites
  • Asn-Xaa-Ser/Thr (Xaa cannot be proline)
  • Unpaired sulfhydryl groups
  • Non-germline frame zone sequence in the variable zone
  • Total hydrophilic average (GRAVY)
  • High Viscosity Index (HVI)
  • Solubility (CamSol)
  • ...
In silico analysis
In silico analysis
  • Hydrophobic cluster
  • Total hydrophobic clusters
  • Near CDR hydrophobic cluster
  • Charge cluster
  • Total charge cluster
  • Near CDR positive charge cluster
  • Near CDR negative charge cluster
  • Variable zone net charge
  • Solubility (CamSol- after structural correction)
  • Developability index (DI)
  • Aggregation-prone regions
  • Therapeutic Protein Indicator
  • Viscosity (SCM/ Deep SCM)
  • Protein structure and antibody-antigen structure prediction (AlphaFold3/IgFold)
  • Protein Fingerprint map (FiveFold)
  • ...